Recombinant Human LIN28A protein, Arginine-tagged
Cat.No. : | LIN28A-129H |
Product Overview : | Recombinant human Lin28-11R protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVH QSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK ECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNESGGGGSPGRRRRRRR RRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for RNA/Protein binding assay.3. As specific protein substrate for kinase assay or other in vitro assay. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
Gene Name | LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ] |
Official Symbol | LIN28A |
Synonyms | LIN28A; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; LIN28; LIN-28; lin-28A; |
Gene ID | 79727 |
mRNA Refseq | NM_024674 |
Protein Refseq | NP_078950 |
MIM | 611043 |
UniProt ID | Q9H9Z2 |
Chromosome Location | 1p35.3 |
Function | DNA binding; RNA binding; mRNA binding; metal ion binding; miRNA binding; protein binding; translation initiation factor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
LIN28A-8766H | Recombinant Human LIN28A protein, His-tagged | +Inquiry |
LIN28A-3938H | Recombinant Human LIN28A protein(1-209aa), His-SUMO-tagged | +Inquiry |
LIN28A-01HFL | Recombinant Full Length Human LIN28A Protein | +Inquiry |
LIN28A-643H | Recombinant Human LIN28A Protein | +Inquiry |
LIN28A-1296H | Recombinant Human LIN28A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN28A-4734HCL | Recombinant Human LIN28A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIN28A Products
Required fields are marked with *
My Review for All LIN28A Products
Required fields are marked with *