Recombinant Human LIN28A protein, Arginine-tagged

Cat.No. : LIN28A-129H
Product Overview : Recombinant human Lin28-11R protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVH QSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK ECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNESGGGGSPGRRRRRRR RRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for RNA/Protein binding assay.3. As specific protein substrate for kinase assay or other in vitro assay.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
Official Symbol LIN28A
Synonyms LIN28A; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; LIN28; LIN-28; lin-28A;
Gene ID 79727
mRNA Refseq NM_024674
Protein Refseq NP_078950
MIM 611043
UniProt ID Q9H9Z2
Chromosome Location 1p35.3
Function DNA binding; RNA binding; mRNA binding; metal ion binding; miRNA binding; protein binding; translation initiation factor binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIN28A Products

Required fields are marked with *

My Review for All LIN28A Products

Required fields are marked with *

0
cart-icon