Recombinant Human LIN28A protein, Arginine-tagged

• Cat.No.: LIN28A-129H
• Product Overview: Recombinant human Lin28-11R protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVH QSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK ECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNESGGGGSPGRRRRRRR RRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for RNA/Protein binding assay.3. As specific protein substrate for kinase assay or other in vitro assay.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days

Gene Information

• Gene Name: LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
• Official Symbol: LIN28A
• Synonyms: LIN28A; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; LIN28; LIN-28; lin-28A
• Gene ID: 79727
• mRNA Refseq: NM_024674
• Protein Refseq: NP_078950
• MIM: 611043
• UniProt ID: Q9H9Z2
• Chromosome Location: 1p35.3
• Function: DNA binding; RNA binding; mRNA binding; metal ion binding; miRNA binding; protein binding; translation initiation factor binding; zinc ion binding