Recombinant Human LIN28A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LIN28A-3677H |
Product Overview : | LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LIN28A lin-28 homolog A [ Homo sapiens (human) ] |
Official Symbol | LIN28A |
Synonyms | LIN28A; lin-28 homolog A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1 |
Gene ID | 79727 |
mRNA Refseq | NM_024674 |
Protein Refseq | NP_078950 |
MIM | 611043 |
UniProt ID | Q9H9Z2 |
◆ Recombinant Proteins | ||
LIN28A-8767H | Recombinant Human LIN28A protein, GST-tagged | +Inquiry |
LIN28A-8467H | Recombinant Human LIN28A, His-tagged | +Inquiry |
LIN28A-129H | Recombinant Human LIN28A protein, Arginine-tagged | +Inquiry |
LIN28A-11314Z | Recombinant Zebrafish LIN28A | +Inquiry |
Lin28a-3785M | Recombinant Mouse Lin28a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN28A-4734HCL | Recombinant Human LIN28A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIN28A Products
Required fields are marked with *
My Review for All LIN28A Products
Required fields are marked with *