Recombinant Human LIN28A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LIN28A-3677H
Product Overview : LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.
Molecular Mass : 22.7 kDa
AA Sequence : MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LIN28A lin-28 homolog A [ Homo sapiens (human) ]
Official Symbol LIN28A
Synonyms LIN28A; lin-28 homolog A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1
Gene ID 79727
mRNA Refseq NM_024674
Protein Refseq NP_078950
MIM 611043
UniProt ID Q9H9Z2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIN28A Products

Required fields are marked with *

My Review for All LIN28A Products

Required fields are marked with *

0
cart-icon