Recombinant Human LIN28A Protein
Cat.No. : | LIN28A-29947TH |
Product Overview : | Recombinant Human LIN28 produced in E. coli is a single, non-glycosylated polypeptide chain containing 222 amino acids (including 13- residue C-terminal TAT peptide). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | TAT |
Description : | This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. |
Form : | Sterile filtered colorless solution. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNGGYGRKKRRQRRR. |
Purity : | Greater than 90% as determined by SDS-PAGE (coomassie staining). |
Notes : | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Storage : | Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
Storage Buffer : | The LIN28 protein solution was formulated in PBS with 50mM arginine |
Shipping : | Shipped with Ice Packs |
Gene Name | LIN28A lin-28 homolog A [ Homo sapiens (human) ] |
Official Symbol | LIN28A |
Synonyms | LIN28A; lin-28 homolog A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1 |
Gene ID | 79727 |
mRNA Refseq | NM_024674 |
Protein Refseq | NP_078950 |
MIM | 611043 |
UniProt ID | Q9H9Z2 |
◆ Recombinant Proteins | ||
LIN28A-5089M | Recombinant Mouse LIN28A Protein, His (Fc)-Avi-tagged | +Inquiry |
LIN28A-8767H | Recombinant Human LIN28A protein, GST-tagged | +Inquiry |
LIN28A-01HFL | Recombinant Full Length Human LIN28A Protein | +Inquiry |
PF4V1-257H | Recombinant Human Lin-28 Homolog A (C. elegans), His-tagged | +Inquiry |
LIN28A-4355H | Recombinant Human LIN28A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN28A-4734HCL | Recombinant Human LIN28A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIN28A Products
Required fields are marked with *
My Review for All LIN28A Products
Required fields are marked with *
0
Inquiry Basket