Recombinant Human LMAN2 Protein, HIS-tagged

Cat.No. : LMAN2-053H
Product Overview : Recombinant Human LMAN2 fused with His tag at C-termina was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control.
Form : Lyophilized from a 0.2 µM filtered solution of 50mM TrisHCI,10mM GSH,pH8.0
Molecular Mass : 32.7kD
AA Sequence : DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name LMAN2 lectin, mannose-binding 2 [ Homo sapiens ]
Official Symbol LMAN2
Synonyms LMAN2; lectin, mannose-binding 2; C5orf8, chromosome 5 open reading frame 8; vesicular integral-membrane protein VIP36; GP36B; VIP36; glycoprotein GP36b; vesicular integral protein of 36 kDa; vesicular integral-membrane protein 36; C5orf8;
Gene ID 10960
mRNA Refseq NM_006816
Protein Refseq NP_006807
MIM 609551
UniProt ID Q12907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMAN2 Products

Required fields are marked with *

My Review for All LMAN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon