Recombinant Human LMNB1 protein, His-tagged
Cat.No. : | LMNB1-216H |
Product Overview : | Recombinant Human LMNB1 protein(NP_001185486)(237-587 aa), fused to His tag, was expressed in E. coli. |
Availability | September 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237-587 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | LMNB1 lamin B1 [ Homo sapiens ] |
Official Symbol | LMNB1 |
Synonyms | LMNB1; lamin B1; lamin-B1; LMN; ADLD; LMN2; LMNB; MGC111419; |
Gene ID | 4001 |
mRNA Refseq | NM_001198557 |
Protein Refseq | NP_001185486 |
MIM | 150340 |
UniProt ID | P20700 |
◆ Recombinant Proteins | ||
LMNB1-29911TH | Recombinant Human LMNB1 | +Inquiry |
LMNB1-285HF | Recombinant Full Length Human LMNB1 Protein | +Inquiry |
LMNB1-1305H | Recombinant Human LMNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMNB1-3428R | Recombinant Rat LMNB1 Protein | +Inquiry |
LMNB1-4449H | Recombinant Human LMNB1 Protein (Ala426-Glu558), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMNB1-994HCL | Recombinant Human LMNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMNB1 Products
Required fields are marked with *
My Review for All LMNB1 Products
Required fields are marked with *