Recombinant Human LMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LMO2-777H
Product Overview : LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 18.2 kDa
AA Sequence : MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LMO2 LIM domain only 2 [ Homo sapiens (human) ]
Official Symbol LMO2
Synonyms LMO2; LIM domain only 2 (rhombotin-like 1); RBTNL1; rhombotin-2; RBTN2; RHOM2; rhombotin like 1; T cell translocation gene 2; TTG2; LMO-2; rhombotin 2; rhombotin-like 1; LIM domain only protein 2; T-cell translocation gene 2; cysteine-rich protein TTG-2; T-cell translocation protein 2;
Gene ID 4005
mRNA Refseq NM_005574
Protein Refseq NP_005565
MIM 180385
UniProt ID P25791

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMO2 Products

Required fields are marked with *

My Review for All LMO2 Products

Required fields are marked with *

0
cart-icon
0
compare icon