Recombinant Human LMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LMO2-777H |
| Product Overview : | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 18.2 kDa |
| AA Sequence : | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LMO2 LIM domain only 2 [ Homo sapiens (human) ] |
| Official Symbol | LMO2 |
| Synonyms | LMO2; LIM domain only 2 (rhombotin-like 1); RBTNL1; rhombotin-2; RBTN2; RHOM2; rhombotin like 1; T cell translocation gene 2; TTG2; LMO-2; rhombotin 2; rhombotin-like 1; LIM domain only protein 2; T-cell translocation gene 2; cysteine-rich protein TTG-2; T-cell translocation protein 2; |
| Gene ID | 4005 |
| mRNA Refseq | NM_005574 |
| Protein Refseq | NP_005565 |
| MIM | 180385 |
| UniProt ID | P25791 |
| ◆ Recombinant Proteins | ||
| LMO2-777H | Recombinant Human LMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LMO2-2534R | Recombinant Rhesus monkey LMO2 Protein, His-tagged | +Inquiry |
| LMO2-2399H | Recombinant Human LMO2 Protein, His-tagged | +Inquiry |
| LMO2-2354R | Recombinant Rhesus Macaque LMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LMO2-8735Z | Recombinant Zebrafish LMO2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LMO2-4710HCL | Recombinant Human LMO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMO2 Products
Required fields are marked with *
My Review for All LMO2 Products
Required fields are marked with *
