Recombinant Human LOX protein, His-SUMO & Myc-tagged

Cat.No. : LOX-3180H
Product Overview : Recombinant Human LOX protein(P28300)(169-417aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.
Availability October 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 169-417aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 49 kDa
AA Sequence : DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name LOX lysyl oxidase [ Homo sapiens ]
Official Symbol LOX
Synonyms LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112;
Gene ID 4015
mRNA Refseq NM_001178102
Protein Refseq NP_001171573
MIM 153455
UniProt ID P28300

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOX Products

Required fields are marked with *

My Review for All LOX Products

Required fields are marked with *

0
cart-icon
0
compare icon