Recombinant Human LOX protein, MBP&His-tagged
| Cat.No. : | LOX-2239H |
| Product Overview : | Recombinant Human LOX protein(P28300)(169-417aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&MBP |
| Protein Length : | 169-417aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 73 kDa |
| AA Sequence : | DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LOX lysyl oxidase [ Homo sapiens ] |
| Official Symbol | LOX |
| Synonyms | LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112; |
| Gene ID | 4015 |
| mRNA Refseq | NM_001178102 |
| Protein Refseq | NP_001171573 |
| MIM | 153455 |
| UniProt ID | P28300 |
| ◆ Recombinant Proteins | ||
| LOX-3432R | Recombinant Rat LOX Protein | +Inquiry |
| Lox-7912M | Recombinant Mouse Lox protein, His & GST-tagged | +Inquiry |
| LOX-213HFL | Active Recombinant Full Length Human LOX Protein, C-Flag-tagged | +Inquiry |
| LOX-628R | Recombinant Rat LOX Protein (163-411 aa), His-tagged | +Inquiry |
| LOX-3088R | Recombinant Rat LOX Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LOX-41 | Active Native Lactate Oxidase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *



