Recombinant Human LOX protein, MBP&His-tagged
Cat.No. : | LOX-2239H |
Product Overview : | Recombinant Human LOX protein(P28300)(169-417aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&MBP |
Protein Length : | 169-417aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73 kDa |
AA Sequence : | DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LOX lysyl oxidase [ Homo sapiens ] |
Official Symbol | LOX |
Synonyms | LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112; |
Gene ID | 4015 |
mRNA Refseq | NM_001178102 |
Protein Refseq | NP_001171573 |
MIM | 153455 |
UniProt ID | P28300 |
◆ Recombinant Proteins | ||
LOX-91H | Active Recombinant Human LOX Protein, Myc/DDK-tagged | +Inquiry |
LOX-1092H | Recombinant Human LOX Protein, His-tagged | +Inquiry |
Lox-1333M | Recombinant Mouse Lox Protein, MYC/DDK-tagged | +Inquiry |
Lox-7912M | Recombinant Mouse Lox protein, His & GST-tagged | +Inquiry |
LOX-4450H | Recombinant Human FMOD (Met1-Trp26) and LOX (Ala22-Tyr417) Protein, N-TwinStrep tagged | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *
0
Inquiry Basket