Recombinant Human LOXL3 Protein, GST-tagged

Cat.No. : LOXL3-4730H
Product Overview : Human LOXL3 partial ORF ( NP_115992, 171 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : IRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTAR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOXL3 lysyl oxidase-like 3 [ Homo sapiens ]
Official Symbol LOXL3
Synonyms LOXL3; lysyl oxidase-like 3; lysyl oxidase homolog 3; lysyl oxidase-like protein 3; LOXL;
Gene ID 84695
mRNA Refseq NM_032603
Protein Refseq NP_115992
MIM 607163
UniProt ID P58215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOXL3 Products

Required fields are marked with *

My Review for All LOXL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon