Recombinant Human LOXL3 Protein, GST-tagged
Cat.No. : | LOXL3-4730H |
Product Overview : | Human LOXL3 partial ORF ( NP_115992, 171 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTAR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LOXL3 lysyl oxidase-like 3 [ Homo sapiens ] |
Official Symbol | LOXL3 |
Synonyms | LOXL3; lysyl oxidase-like 3; lysyl oxidase homolog 3; lysyl oxidase-like protein 3; LOXL; |
Gene ID | 84695 |
mRNA Refseq | NM_032603 |
Protein Refseq | NP_115992 |
MIM | 607163 |
UniProt ID | P58215 |
◆ Recombinant Proteins | ||
LOXL3-1979H | Active Recombinant Human Lysyl Oxidase-Like 3, His-tagged | +Inquiry |
LOXL3-277H | Recombinant Human LOXL3 Protein, His-tagged | +Inquiry |
LOXL3-1419H | Recombinant Human LOXL3 protein, His-GST-tagged | +Inquiry |
Loxl3-278M | Recombinant Mouse Loxl3 Protein, His-tagged | +Inquiry |
LOXL3-5133M | Recombinant Mouse LOXL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LOXL3 Products
Required fields are marked with *
My Review for All LOXL3 Products
Required fields are marked with *
0
Inquiry Basket