"LOXL4" Related Products

Expand
Expand

Recombinant Human LOXL4 protein, GST-tagged

Cat.No.: LOXL4-2157H
Product Overview: Recombinant Human LOXL4 fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 110.9 kDa
AA Sequence: MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDDNFAIQEATVACRQLG FEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVSDCSHSEDVGVICHPRRHRGYLSETVSNALG PQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWD LKMRDPKSRLKSLTNKNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTRPQ RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGARLGQGLGPIHL SEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGSVC SENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAG VSCMDSAPDLVMNAQLVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYR HDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQR LRNNLI
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: LOXL4 lysyl oxidase-like 4 [ Homo sapiens ]
Official Symbol: LOXL4
Synonyms: LOXL4; lysyl oxidase-like 4; lysyl oxidase homolog 4; FLJ21889; LOXC; lysyl oxidase related C; lysyl oxidase-like protein 4; lysyl oxidase-like 4 pseudogene; lysyl oxidase-related protein C;
Gene ID: 84171
mRNA Refseq: NM_032211
Protein Refseq: NP_115587
MIM: 607318
UniProt ID: Q96JB6
Chromosome Location: 10q24
Pathway: Assembly of collagen fibrils and other multimeric structures, organism-specific biosystem; Collagen formation, organism-specific biosystem; Crosslinking of collagen fibrils, organism-specific biosystem
Function: copper ion binding; metal ion binding; oxidoreductase activity; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.