Recombinant Human LOXL4 protein, GST-tagged LOXL4-2157H

Recombinant Human LOXL4 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LOXL4 protein, GST-tagged

Recombinant Human LOXL4 protein, GST-tagged

LOXL4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LOXL4-2157H
Product Overview : Recombinant Human LOXL4 fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 110.9 kDa
AA Sequence : MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDDNFAIQEATVACRQLG FEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVSDCSHSEDVGVICHPRRHRGYLSETVSNALG PQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWD LKMRDPKSRLKSLTNKNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTRPQ RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGARLGQGLGPIHL SEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGSVC SENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAG VSCMDSAPDLVMNAQLVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYR HDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQR LRNNLI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : LOXL4 lysyl oxidase-like 4 [ Homo sapiens ]
Official Symbol : LOXL4
Synonyms : LOXL4; lysyl oxidase-like 4; lysyl oxidase homolog 4; FLJ21889; LOXC; lysyl oxidase related C; lysyl oxidase-like protein 4; lysyl oxidase-like 4 pseudogene; lysyl oxidase-related protein C;
Gene ID : 84171
mRNA Refseq : NM_032211
Protein Refseq : NP_115587
MIM : 607318
UniProt ID : Q96JB6
Chromosome Location : 10q24
Pathway : Assembly of collagen fibrils and other multimeric structures, organism-specific biosystem; Collagen formation, organism-specific biosystem; Crosslinking of collagen fibrils, organism-specific biosystem
Function : copper ion binding; metal ion binding; oxidoreductase activity; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy