Recombinant Human LPAR4 Protein

Cat.No. : LPAR4-4724H
Product Overview : Human LPAR4 full-length ORF (NP_005287.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation. [provided by RefSeq
Form : Liquid
Molecular Mass : 41.9 kDa
AA Sequence : MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LPAR4 lysophosphatidic acid receptor 4 [ Homo sapiens ]
Official Symbol LPAR4
Synonyms LPAR4; lysophosphatidic acid receptor 4; G protein coupled receptor 23 , GPR23; LPA4; P2RY9; P2Y5 LIKE; P2Y9; LPA-4; LPA receptor 4; P2Y purinoceptor 9; P2Y5-like receptor; purinergic receptor 9; G protein-coupled receptor 23; G-protein coupled receptor 23; GPR23; P2Y5-LIKE;
Gene ID 2846
mRNA Refseq NM_005296
Protein Refseq NP_005287
MIM 300086
UniProt ID Q99677

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LPAR4 Products

Required fields are marked with *

My Review for All LPAR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon