Recombinant Human LRGUK Protein, GST-tagged

Cat.No. : LRGUK-4308H
Product Overview : Human FLJ32786 partial ORF ( NP_653249, 721 a.a. - 825 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRGUK (Leucine Rich Repeats And Guanylate Kinase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is LRRC23.
Molecular Mass : 37.29 kDa
AA Sequence : YFKPPFGPYPEKSGKDSLVSMKCSLFRFCPWSKELPFQPPEGSISSHLGSGASDSETEETRKALPIQSFSHEKESHQHRQHSVPVISRPGSNVKPTLPPIPQGRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRGUK leucine-rich repeats and guanylate kinase domain containing [ Homo sapiens ]
Official Symbol LRGUK
Synonyms LRGUK; leucine-rich repeats and guanylate kinase domain containing; leucine-rich repeat and guanylate kinase domain-containing protein; FLJ32786;
Gene ID 136332
mRNA Refseq NM_144648
Protein Refseq NP_653249
MIM 616478
UniProt ID Q96M69

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRGUK Products

Required fields are marked with *

My Review for All LRGUK Products

Required fields are marked with *

0
cart-icon
0
compare icon