Recombinant Human LRGUK Protein, GST-tagged
Cat.No. : | LRGUK-4308H |
Product Overview : | Human FLJ32786 partial ORF ( NP_653249, 721 a.a. - 825 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRGUK (Leucine Rich Repeats And Guanylate Kinase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is LRRC23. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | YFKPPFGPYPEKSGKDSLVSMKCSLFRFCPWSKELPFQPPEGSISSHLGSGASDSETEETRKALPIQSFSHEKESHQHRQHSVPVISRPGSNVKPTLPPIPQGRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRGUK leucine-rich repeats and guanylate kinase domain containing [ Homo sapiens ] |
Official Symbol | LRGUK |
Synonyms | LRGUK; leucine-rich repeats and guanylate kinase domain containing; leucine-rich repeat and guanylate kinase domain-containing protein; FLJ32786; |
Gene ID | 136332 |
mRNA Refseq | NM_144648 |
Protein Refseq | NP_653249 |
MIM | 616478 |
UniProt ID | Q96M69 |
◆ Recombinant Proteins | ||
LRGUK-9222M | Recombinant Mouse LRGUK Protein | +Inquiry |
LRGUK-5155M | Recombinant Mouse LRGUK Protein, His (Fc)-Avi-tagged | +Inquiry |
LRGUK-4308H | Recombinant Human LRGUK Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRGUK Products
Required fields are marked with *
My Review for All LRGUK Products
Required fields are marked with *