Recombinant Human LRIG3 Protein, GST-tagged
Cat.No. : | LRIG3-4702H |
Product Overview : | Human LRIG3 partial ORF ( NP_700356, 1020 a.a. - 1119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRIG3 (Leucine Rich Repeats And Immunoglobulin Like Domains 3) is a Protein Coding gene. An important paralog of this gene is LRIG2. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRIG3 leucine-rich repeats and immunoglobulin-like domains 3 [ Homo sapiens ] |
Official Symbol | LRIG3 |
Synonyms | LRIG3; leucine-rich repeats and immunoglobulin-like domains 3; leucine-rich repeats and immunoglobulin-like domains protein 3; FLJ90440; KIAA3016; LIG-3; LIG3; FLJ26573; |
Gene ID | 121227 |
mRNA Refseq | NM_001136051 |
Protein Refseq | NP_001129523 |
MIM | 608870 |
UniProt ID | Q6UXM1 |
◆ Recombinant Proteins | ||
LRIG3-9226M | Recombinant Mouse LRIG3 Protein | +Inquiry |
LRIG3-6138Z | Recombinant Zebrafish LRIG3 | +Inquiry |
LRIG3-4386C | Recombinant Chicken LRIG3 | +Inquiry |
LRIG3-5157M | Recombinant Mouse LRIG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRIG3-4702H | Recombinant Human LRIG3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRIG3 Products
Required fields are marked with *
My Review for All LRIG3 Products
Required fields are marked with *