Recombinant Human LRIG3 Protein, GST-tagged

Cat.No. : LRIG3-4702H
Product Overview : Human LRIG3 partial ORF ( NP_700356, 1020 a.a. - 1119 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRIG3 (Leucine Rich Repeats And Immunoglobulin Like Domains 3) is a Protein Coding gene. An important paralog of this gene is LRIG2.
Molecular Mass : 36.74 kDa
AA Sequence : LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRIG3 leucine-rich repeats and immunoglobulin-like domains 3 [ Homo sapiens ]
Official Symbol LRIG3
Synonyms LRIG3; leucine-rich repeats and immunoglobulin-like domains 3; leucine-rich repeats and immunoglobulin-like domains protein 3; FLJ90440; KIAA3016; LIG-3; LIG3; FLJ26573;
Gene ID 121227
mRNA Refseq NM_001136051
Protein Refseq NP_001129523
MIM 608870
UniProt ID Q6UXM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRIG3 Products

Required fields are marked with *

My Review for All LRIG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon