Recombinant Human LRP12, His-tagged

Cat.No. : LRP12-196H
Product Overview : Recombinant Human Low-Density Lipoprotein Receptor-Related Protein 12/LRP12 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu33-Arg492) of Human ST7 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 33-492 a.a.
Description : Low-Density Lipoprotein Receptor-Related Protein 12 (LRP12) belongs to the LDLR family. LRP12 is a type I transmembrane protein annd widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas. LRP12 contains 2 CUB domain and 5 LDL-receptor class A domain. LRP12 has been shown to interact with GNB2L1, ZFYVE9 and ITGB1BP3. LRP12 is a receptor probably, which may be involved in the internalization of lipophilic molecules and/or signal transduction. In addition, LRP12 may act as a tumor suppressor.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : EHSENVHISGVSTACGETPEQIRAPSGIITSPGWPSEYPAKINCSWFIRANPGEIITISFQDFDI QGSRRCNLDWLTIETYKNIESYRACGSTIPPPYISSQDHIWIRFHSDDNISRKGFRLAYFSGKSE EPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEANPPTAAAFQPCAYNQFQCLSRFT KVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTG DHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCAD KVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDETNCTMCQKEEFPCSR NGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPV IVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name LRP12 low density lipoprotein receptor-related protein 12 [ Homo sapiens ]
Official Symbol LRP12
Synonyms LRP12; low density lipoprotein receptor-related protein 12; low-density lipoprotein receptor-related protein 12; FLJ12929; ST7; suppressor of tumorigenicity 7 protein; DKFZp781F1053;
Gene ID 29967
mRNA Refseq NM_001135703
Protein Refseq NP_001129175
UniProt ID Q9Y561
Chromosome Location 8q22.2
Function low-density lipoprotein receptor activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRP12 Products

Required fields are marked with *

My Review for All LRP12 Products

Required fields are marked with *

0
cart-icon