Recombinant Full Length Human LRP12 Protein, GST-tagged
Cat.No. : | LRP12-6014HF |
Product Overview : | Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 129 amino acids |
Description : | This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 39.93 kDa |
AA Sequence : | MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRP12 low density lipoprotein receptor-related protein 12 [ Homo sapiens ] |
Official Symbol | LRP12 |
Synonyms | LRP12; low density lipoprotein receptor-related protein 12; low-density lipoprotein receptor-related protein 12; FLJ12929; ST7; suppressor of tumorigenicity 7 protein; DKFZp781F1053; |
Gene ID | 29967 |
mRNA Refseq | NM_001135703 |
Protein Refseq | NP_001129175 |
MIM | 618299 |
UniProt ID | Q9Y561 |
◆ Recombinant Proteins | ||
LRP12-196H | Recombinant Human LRP12, His-tagged | +Inquiry |
LRP12-4694H | Recombinant Human LRP12 Protein, GST-tagged | +Inquiry |
LRP12-6014HF | Recombinant Full Length Human LRP12 Protein, GST-tagged | +Inquiry |
LRP12-5161M | Recombinant Mouse LRP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRP12-5374Z | Recombinant Zebrafish LRP12 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRP12 Products
Required fields are marked with *
My Review for All LRP12 Products
Required fields are marked with *