Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged
| Cat.No. : | LRP2-1448H |
| Product Overview : | Recombinant Human LRP2 Protein (1186-1389 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1186-1389 aa |
| Description : | Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.2 kDa |
| AA Sequence : | NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ] |
| Official Symbol | LRP2 |
| Synonyms | LRP2; DBS; gp330; megalin; LRP-2; glycoprotein 330; GP330; |
| Gene ID | 4036 |
| mRNA Refseq | NM_004525 |
| Protein Refseq | NP_004516 |
| MIM | 600073 |
| UniProt ID | P98164 |
| ◆ Recombinant Proteins | ||
| LRP2-5162M | Recombinant Mouse LRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRP2-7443H | Recombinant Human LRP2 protein, His-tagged | +Inquiry |
| LRP2-1448H | Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged | +Inquiry |
| LRP2-3453R | Recombinant Rat LRP2 Protein | +Inquiry |
| LRP2-3109R | Recombinant Rat LRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRP2 Products
Required fields are marked with *
My Review for All LRP2 Products
Required fields are marked with *
