Recombinant Human LRRC17 protein, His-KSI-tagged

Cat.No. : LRRC17-8223H
Product Overview : Recombinant Human LRRC17 protein(Q8N6Y2)(19-249aa), fused with N-terminal His and KSI tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&KSI
Protein Length : 19-249aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.2 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPI
Gene Name LRRC17 leucine rich repeat containing 17 [ Homo sapiens ]
Official Symbol LRRC17
Synonyms LRRC17; leucine rich repeat containing 17; leucine-rich repeat-containing protein 17; H_RG318M05.3; P37NB; 37 kDa leucine-rich repeat (LRR) protein;
Gene ID 10234
mRNA Refseq NM_001031692
Protein Refseq NP_001026862
UniProt ID Q8N6Y2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC17 Products

Required fields are marked with *

My Review for All LRRC17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon