Recombinant Human LRRC17 protein, His-KSI-tagged
Cat.No. : | LRRC17-8223H |
Product Overview : | Recombinant Human LRRC17 protein(Q8N6Y2)(19-249aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 19-249aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPI |
Gene Name | LRRC17 leucine rich repeat containing 17 [ Homo sapiens ] |
Official Symbol | LRRC17 |
Synonyms | LRRC17; leucine rich repeat containing 17; leucine-rich repeat-containing protein 17; H_RG318M05.3; P37NB; 37 kDa leucine-rich repeat (LRR) protein; |
Gene ID | 10234 |
mRNA Refseq | NM_001031692 |
Protein Refseq | NP_001026862 |
UniProt ID | Q8N6Y2 |
◆ Recombinant Proteins | ||
LRRC17-5173M | Recombinant Mouse LRRC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC17-11587Z | Recombinant Zebrafish LRRC17 | +Inquiry |
LRRC17-561H | Recombinant Human LRRC17 Protein, His-tagged | +Inquiry |
LRRC17-4180C | Recombinant Chicken LRRC17 | +Inquiry |
LRRC17-4683H | Recombinant Human LRRC17 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC17-4647HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
LRRC17-4648HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC17 Products
Required fields are marked with *
My Review for All LRRC17 Products
Required fields are marked with *