Recombinant Full Length Human LRRC17 Protein, GST-tagged

Cat.No. : LRRC17-6030HF
Product Overview : Human LRRC17 full-length ORF ( AAH27903, 19 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 19-441 amino acids
Description : LRRC17 (Leucine Rich Repeat Containing 17) is a Protein Coding gene. Diseases associated with LRRC17 include Neuroblastoma. An important paralog of this gene is LRRC3.
Molecular Mass : 72.27 kDa
AA Sequence : RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC17 leucine rich repeat containing 17 [ Homo sapiens ]
Official Symbol LRRC17
Synonyms LRRC17; leucine rich repeat containing 17; leucine-rich repeat-containing protein 17; H_RG318M05.3; P37NB; 37 kDa leucine-rich repeat (LRR) protein;
Gene ID 10234
mRNA Refseq NM_001031692
Protein Refseq NP_001026862
MIM 618749
UniProt ID Q8N6Y2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC17 Products

Required fields are marked with *

My Review for All LRRC17 Products

Required fields are marked with *

0
cart-icon