Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LRRC18-6526H
• Product Overview: LRRC18 MS Standard C13 and N15-labeled recombinant protein (NP_001006940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Deafness, Autosomal Recessive 33 and Usher Syndrome, Type Ik. An important paralog of this gene is SCRIB.
• Molecular Mass: 29.7 kDa
• AA Sequence: MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LRRC18 leucine rich repeat containing 18 [ Homo sapiens (human) ]
• Official Symbol: LRRC18
• Synonyms: LRRC18; leucine rich repeat containing 18; UNQ933; UNQ9338; VKGE9338; leucine-rich repeat-containing protein 18
• Gene ID: 474354
• mRNA Refseq: NM_001006939
• Protein Refseq: NP_001006940
• MIM: 619002
• UniProt ID: Q8N456