Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LRRC18-6526H
Product Overview : LRRC18 MS Standard C13 and N15-labeled recombinant protein (NP_001006940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Deafness, Autosomal Recessive 33 and Usher Syndrome, Type Ik. An important paralog of this gene is SCRIB.
Molecular Mass : 29.7 kDa
AA Sequence : MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LRRC18 leucine rich repeat containing 18 [ Homo sapiens (human) ]
Official Symbol LRRC18
Synonyms LRRC18; leucine rich repeat containing 18; UNQ933; UNQ9338; VKGE9338; leucine-rich repeat-containing protein 18
Gene ID 474354
mRNA Refseq NM_001006939
Protein Refseq NP_001006940
MIM 619002
UniProt ID Q8N456

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC18 Products

Required fields are marked with *

My Review for All LRRC18 Products

Required fields are marked with *

0
cart-icon