Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LRRC18-6526H |
Product Overview : | LRRC18 MS Standard C13 and N15-labeled recombinant protein (NP_001006940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Deafness, Autosomal Recessive 33 and Usher Syndrome, Type Ik. An important paralog of this gene is SCRIB. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LRRC18 leucine rich repeat containing 18 [ Homo sapiens (human) ] |
Official Symbol | LRRC18 |
Synonyms | LRRC18; leucine rich repeat containing 18; UNQ933; UNQ9338; VKGE9338; leucine-rich repeat-containing protein 18 |
Gene ID | 474354 |
mRNA Refseq | NM_001006939 |
Protein Refseq | NP_001006940 |
MIM | 619002 |
UniProt ID | Q8N456 |
◆ Recombinant Proteins | ||
LRRC18-6526H | Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lrrc18-3824M | Recombinant Mouse Lrrc18 Protein, Myc/DDK-tagged | +Inquiry |
LRRC18-5174M | Recombinant Mouse LRRC18 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC18-5946HF | Recombinant Full Length Human LRRC18 Protein, GST-tagged | +Inquiry |
LRRC18-3116R | Recombinant Rat LRRC18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC18 Products
Required fields are marked with *
My Review for All LRRC18 Products
Required fields are marked with *
0
Inquiry Basket