Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LRRC18-6526H |
| Product Overview : | LRRC18 MS Standard C13 and N15-labeled recombinant protein (NP_001006940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Deafness, Autosomal Recessive 33 and Usher Syndrome, Type Ik. An important paralog of this gene is SCRIB. |
| Molecular Mass : | 29.7 kDa |
| AA Sequence : | MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LRRC18 leucine rich repeat containing 18 [ Homo sapiens (human) ] |
| Official Symbol | LRRC18 |
| Synonyms | LRRC18; leucine rich repeat containing 18; UNQ933; UNQ9338; VKGE9338; leucine-rich repeat-containing protein 18 |
| Gene ID | 474354 |
| mRNA Refseq | NM_001006939 |
| Protein Refseq | NP_001006940 |
| MIM | 619002 |
| UniProt ID | Q8N456 |
| ◆ Recombinant Proteins | ||
| LRRC18-3116R | Recombinant Rat LRRC18 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC18-5946HF | Recombinant Full Length Human LRRC18 Protein, GST-tagged | +Inquiry |
| Lrrc18-3824M | Recombinant Mouse Lrrc18 Protein, Myc/DDK-tagged | +Inquiry |
| LRRC18-4682H | Recombinant Human LRRC18 Protein, GST-tagged | +Inquiry |
| LRRC18-6526H | Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC18 Products
Required fields are marked with *
My Review for All LRRC18 Products
Required fields are marked with *
