Recombinant Human LRRC3B, His-tagged
Cat.No. : | LRRC3B-129H |
Product Overview : | Recombinant Human Leucine-Rich Repeat-Containing Protein 3B/LRRC3B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys34-Tyr204) of Human LRRC3B fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 34-204 a.a. |
Description : | Leucine-Rich Repeat-Containing Protein 3B (LRRC3B) belongs to the LRRC3 family. LRRC3B is single-pass membrane protein and contains three leucine-rich repeats, one LRRCT domain, and one LRRNT domain. LRR-containing proteins, of which there are greater than 2,000, participate in many important processes, including plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. A number of microarray expression profiling studies on human cancers have shown that LRRC3B is down-regulated in gastric, breast, colon, testis, prostate and brain cancers, suggesting LRRC3B involvement in carcinogenesis |
AA Sequence : | CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKN GIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASN HETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
LRRC3B-5965HF | Recombinant Full Length Human LRRC3B Protein, GST-tagged | +Inquiry |
LRRC3B-651H | Recombinant Human LRRC3B Protein, Fc-tagged | +Inquiry |
LRRC3B-4668H | Recombinant Human LRRC3B Protein, GST-tagged | +Inquiry |
LRRC3B-2559R | Recombinant Rhesus monkey LRRC3B Protein, His-tagged | +Inquiry |
RFL13187MF | Recombinant Full Length Mouse Leucine-Rich Repeat-Containing Protein 3B(Lrrc3B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC3B-4631HCL | Recombinant Human LRRC3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC3B Products
Required fields are marked with *
My Review for All LRRC3B Products
Required fields are marked with *