Recombinant Human LRSAM1, His-tagged
| Cat.No. : | LRSAM1-29433TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 491-723 of Human LRSAM1 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 491-723 a.a. |
| Description : | LRSAM1 is a multifunctional RING finger protein that selectively regulates cell adhesion molecules, has ubiquitin ligase activity, and plays a role in receptor endocytosis and viral budding (Li et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 149 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELR EILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEE GMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPG DLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMG EVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIYHS S |
| Gene Name | LRSAM1 leucine rich repeat and sterile alpha motif containing 1 [ Homo sapiens ] |
| Official Symbol | LRSAM1 |
| Synonyms | LRSAM1; leucine rich repeat and sterile alpha motif containing 1; E3 ubiquitin-protein ligase LRSAM1; FLJ31641; |
| Gene ID | 90678 |
| mRNA Refseq | NM_001190723 |
| Protein Refseq | NP_001177652 |
| MIM | 610933 |
| Uniprot ID | Q6UWE0 |
| Chromosome Location | 9q34.13 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
| Function | hormone activity; ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity; |
| ◆ Recombinant Proteins | ||
| LRSAM1-4624H | Recombinant Human LRSAM1 Protein, GST-tagged | +Inquiry |
| LRSAM1-2794H | Recombinant Human LRSAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LRSAM1-2342H | Recombinant Human LRSAM1 Protein, MYC/DDK-tagged | +Inquiry |
| LRSAM1-1702H | Recombinant Human LRSAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Lrsam1-3847M | Recombinant Mouse Lrsam1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRSAM1-1036HCL | Recombinant Human LRSAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRSAM1 Products
Required fields are marked with *
My Review for All LRSAM1 Products
Required fields are marked with *
