Recombinant Human LSM2 Protein, His-tagged
Cat.No. : | LSM2-4612H |
Product Overview : | Human LSM2 (NP_067000, 1 a.a. - 95 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
Form : | Liquid |
Molecular Mass : | 13.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (5 mM DTT, 40% glycerol) |
Gene Name | LSM2 LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ] |
Official Symbol | LSM2 |
Synonyms | LSM2; LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated; G7B; snRNP; C6orf28; YBL026W; U6 snRNA-associated Sm-like protein LSm2; LSM2 U6 small nuclear RNA and mRNA degradation associated; LSM2 homolog, U6 small nuclear RNA associated; protein G7b; small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=57819 |
mRNA Refseq | NM_021177 |
Protein Refseq | NP_067000 |
MIM | 607282 |
UniProt ID | Q9Y333 |
◆ Recombinant Proteins | ||
LSM2-4611H | Recombinant Human LSM2 Protein, GST-tagged | +Inquiry |
LSM2-9331M | Recombinant Mouse LSM2 Protein | +Inquiry |
LSM2-5225M | Recombinant Mouse LSM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM2-2402R | Recombinant Rhesus Macaque LSM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LSM2-4612H | Recombinant Human LSM2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM2-9175HCL | Recombinant Human LSM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM2 Products
Required fields are marked with *
My Review for All LSM2 Products
Required fields are marked with *
0
Inquiry Basket