Recombinant Human LSM3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LSM3-808H |
Product Overview : | LSM3 MS Standard C13 and N15-labeled recombinant protein (NP_055278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LSM3 LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ] |
Official Symbol | LSM3 |
Synonyms | LSM3; LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm3; SMX4; USS2; YLR438C; |
Gene ID | 27258 |
mRNA Refseq | NM_014463 |
Protein Refseq | NP_055278 |
MIM | 607283 |
UniProt ID | P62310 |
◆ Recombinant Proteins | ||
LSM3-2583R | Recombinant Rhesus monkey LSM3 Protein, His-tagged | +Inquiry |
LSM3-9332M | Recombinant Mouse LSM3 Protein | +Inquiry |
LSM3-5995HF | Recombinant Full Length Human LSM3 Protein, GST-tagged | +Inquiry |
LSM3-5209C | Recombinant Chicken LSM3 | +Inquiry |
LSM3-2403R | Recombinant Rhesus Macaque LSM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM3-9174HCL | Recombinant Human LSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM3 Products
Required fields are marked with *
My Review for All LSM3 Products
Required fields are marked with *