Recombinant Human LSMEM1 Protein

Cat.No. : LSMEM1 -0151H
Product Overview : Human LSMEM1 full-length ORF (ADR82831.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : LSMEM1 (Leucine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
Form : Liquid
Molecular Mass : 14.5 kDa
AA Sequence : MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LSMEM1 leucine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
Official Symbol LSMEM1
Synonyms LSMEM1; leucine rich single-pass membrane protein 1; Leucine Rich Single-Pass Membrane Protein 1; Leucine-Rich Single-Pass Membrane Protein 1; C7orf53; Chromosome 7 Open Reading Frame 53;
Gene ID 286006
mRNA Refseq NM_182597
Protein Refseq NP_872403
UniProt ID Q8N8F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSMEM1 Products

Required fields are marked with *

My Review for All LSMEM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon