Recombinant Human LSMEM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LSMEM1-5124H |
| Product Overview : | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001127940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LSMEM1 (Leucine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LSMEM1 leucine rich single-pass membrane protein 1 [ Homo sapiens (human) ] |
| Official Symbol | LSMEM1 |
| Synonyms | LSMEM1; leucine rich single-pass membrane protein 1; C7orf53; leucine-rich single-pass membrane protein 1 |
| Gene ID | 286006 |
| mRNA Refseq | NM_001134468 |
| Protein Refseq | NP_001127940 |
| UniProt ID | Q8N8F7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSMEM1 Products
Required fields are marked with *
My Review for All LSMEM1 Products
Required fields are marked with *
