Recombinant Human LSP1 Protein, GST-tagged
Cat.No. : | LSP1-4602H |
Product Overview : | Human LSP1 partial ORF ( NP_002330.1, 240 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSP1 lymphocyte-specific protein 1 [ Homo sapiens ] |
Official Symbol | LSP1 |
Synonyms | LSP1; lymphocyte-specific protein 1; WP34; 52 kDa phosphoprotein; 47 kDa actin binding protein; 47 kDa actin-binding protein; leukocyte-specific protein 1; lymphocyte-specific antigen WP34; leufactin (leukocyte F-actin binding protein); F-actin binding and cytoskeleton associated protein; pp52; |
Gene ID | 4046 |
mRNA Refseq | NM_001013253 |
Protein Refseq | NP_001013271 |
MIM | 153432 |
UniProt ID | P33241 |
◆ Recombinant Proteins | ||
LSP1-2114H | Recombinant Human LSP1 Protein (1-339 aa), GST-tagged | +Inquiry |
LSP1-274H | Recombinant Human LSP1 | +Inquiry |
LSP1-9338M | Recombinant Mouse LSP1 Protein | +Inquiry |
LSP1-1717H | Recombinant Human LSP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LSP1-4602H | Recombinant Human LSP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSP1-9169HCL | Recombinant Human LSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSP1 Products
Required fields are marked with *
My Review for All LSP1 Products
Required fields are marked with *