Recombinant Human LSP1 Protein, GST-tagged

Cat.No. : LSP1-4602H
Product Overview : Human LSP1 partial ORF ( NP_002330.1, 240 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSP1 lymphocyte-specific protein 1 [ Homo sapiens ]
Official Symbol LSP1
Synonyms LSP1; lymphocyte-specific protein 1; WP34; 52 kDa phosphoprotein; 47 kDa actin binding protein; 47 kDa actin-binding protein; leukocyte-specific protein 1; lymphocyte-specific antigen WP34; leufactin (leukocyte F-actin binding protein); F-actin binding and cytoskeleton associated protein; pp52;
Gene ID 4046
mRNA Refseq NM_001013253
Protein Refseq NP_001013271
MIM 153432
UniProt ID P33241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LSP1 Products

Required fields are marked with *

My Review for All LSP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon