Recombinant Human LSS Protein, GST-tagged
| Cat.No. : | LSS-4600H |
| Product Overview : | Human LSS partial ORF ( NP_001001438.1, 633 a.a. - 732 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSS lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) [ Homo sapiens ] |
| Official Symbol | LSS |
| Synonyms | LSS; lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase); lanosterol synthase; OSC; hOSC; oxidosqualene--lanosterol cyclase; 2,3-epoxysqualene-lanosterol cyclase; 2,3-epoxysqualene--lanosterol cyclase; FLJ25486; FLJ35015; FLJ39450; FLJ46393; |
| Gene ID | 4047 |
| mRNA Refseq | NM_001001438 |
| Protein Refseq | NP_001001438 |
| MIM | 600909 |
| UniProt ID | P48449 |
| ◆ Recombinant Proteins | ||
| LSS-5421Z | Recombinant Zebrafish LSS | +Inquiry |
| LSS-2405H | Recombinant Human LSS Protein, His-tagged | +Inquiry |
| Lss-1945R | Recombinant Rat Lss protein, His-tagged | +Inquiry |
| LSS-4600H | Recombinant Human LSS Protein, GST-tagged | +Inquiry |
| LSS-9340M | Recombinant Mouse LSS Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSS-396HCL | Recombinant Human LSS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSS Products
Required fields are marked with *
My Review for All LSS Products
Required fields are marked with *




