Recombinant Human LSS Protein, GST-tagged
Cat.No. : | LSS-4600H |
Product Overview : | Human LSS partial ORF ( NP_001001438.1, 633 a.a. - 732 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LSS lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) [ Homo sapiens ] |
Official Symbol | LSS |
Synonyms | LSS; lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase); lanosterol synthase; OSC; hOSC; oxidosqualene--lanosterol cyclase; 2,3-epoxysqualene-lanosterol cyclase; 2,3-epoxysqualene--lanosterol cyclase; FLJ25486; FLJ35015; FLJ39450; FLJ46393; |
Gene ID | 4047 |
mRNA Refseq | NM_001001438 |
Protein Refseq | NP_001001438 |
MIM | 600909 |
UniProt ID | P48449 |
◆ Recombinant Proteins | ||
LSS-2405H | Recombinant Human LSS Protein, His-tagged | +Inquiry |
LSS-4600H | Recombinant Human LSS Protein, GST-tagged | +Inquiry |
LSS-1516HFL | Recombinant Full Length Human LSS Protein, C-Flag-tagged | +Inquiry |
LSS-1944H | Recombinant Human LSS protein, His-tagged | +Inquiry |
LSS-1322H | Recombinant Human LSS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSS-396HCL | Recombinant Human LSS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSS Products
Required fields are marked with *
My Review for All LSS Products
Required fields are marked with *
0
Inquiry Basket