Recombinant Human LTA protein, His-Avi-tagged, Biotinylated

• Cat.No.: LTA-7253H
• Product Overview: Recombinant Human LTA protein(P01374)(35-205aa), fused with N-terminal His and Avi tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Protein Length: 35-205aa
• Tag: N-His-Avi
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
• Conjugation: Biotin

Gene Information

• Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
• Official Symbol: LTA
• Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1
• Gene ID: 4049
• mRNA Refseq: NM_000595
• Protein Refseq: NP_000586
• MIM: 153440
• UniProt ID: P01374