Recombinant Human LTA protein, His-Avi-tagged, Biotinylated
Cat.No. : | LTA-7253H |
Product Overview : | Recombinant Human LTA protein(P01374)(35-205aa), fused with N-terminal His and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | 35-205aa |
Tag : | N-His-Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
Official Symbol | LTA |
Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
Gene ID | 4049 |
mRNA Refseq | NM_000595 |
Protein Refseq | NP_000586 |
MIM | 153440 |
UniProt ID | P01374 |
◆ Recombinant Proteins | ||
LTA-31074TH | Recombinant Human LTA, His-tagged | +Inquiry |
LTA-570P | Recombinant Pig LTA protein, His & T7-tagged | +Inquiry |
LTA-6059HF | Recombinant Full Length Human LTA Protein, GST-tagged | +Inquiry |
LTA-1253H | Recombinant Human Lymphotoxin Alpha (TNF superfamily, member 1), HQ-tagged | +Inquiry |
LTA-260H | Recombinant Human Lymphotoxin Alpha | +Inquiry |
◆ Native Proteins | ||
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *