Recombinant Human LUC7L3 Protein, GST-tagged
Cat.No. : | LUC7L3-1900H |
Product Overview : | Human CROP full-length ORF ( AAH56409.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2009] |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LUC7L3 LUC7 like 3 pre-mRNA splicing factor [ Homo sapiens (human) ] |
Official Symbol | LUC7L3 |
Synonyms | LUC7L3; LUC7 like 3 pre-mRNA splicing factor; LUC7 Like 3 Pre-MRNA Splicing Factor; Cisplatin Resistance-Associated-Overexpressed Protein; Okadaic Acid-Inducible Phosphoprotein OA48-18; CAMP Regulatory Element-Associated Protein 1; CRE-Associated Protein 1; CREAP-1; LUC7A; CROP; Cisplatin Resistance Associated Overexpressed Protein; LUC7-Like 3 Pre-MRNA Splicing Factor; LUC7-Like 3 (S. Cerevisiae); CRE-Associated Protein; Luc7-Like Protein 3; LUC7-Like 3; OA48-18; HLuc7A; CREAP1; CRA; O48; luc7-like protein 3; CRE-associated protein 1; LUC7-like 3; cAMP regulatory element-associated protein 1; cisplatin resistance-associated-overexpressed protein; okadaic acid-inducible phosphoprotein OA48-18 |
Gene ID | 51747 |
mRNA Refseq | NM_001330330 |
Protein Refseq | NP_001317259 |
MIM | 609434 |
UniProt ID | O95232 |
◆ Recombinant Proteins | ||
LUC7L3-998H | Recombinant Human LUC7L3 Protein (1-79 aa), His-tagged | +Inquiry |
LUC7L3-636H | Recombinant Human LUC7L3 Protein, His-tagged | +Inquiry |
LUC7L3-2592R | Recombinant Rhesus monkey LUC7L3 Protein, His-tagged | +Inquiry |
LUC7L3-5243M | Recombinant Mouse LUC7L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LUC7L3-2091HF | Recombinant Full Length Human LUC7L3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LUC7L3 Products
Required fields are marked with *
My Review for All LUC7L3 Products
Required fields are marked with *
0
Inquiry Basket