Recombinant Human LY6E Protein, GST-tagged
Cat.No. : | LY6E-4570H |
Product Overview : | Human LY6E full-length ORF ( NP_002337.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LY6E (Lymphocyte Antigen 6 Family Member E) is a Protein Coding gene. Diseases associated with LY6E include Leukemia, Acute Promyelocytic, Somatic. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. |
Molecular Mass : | 39.9 kDa |
AA Sequence : | MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ] |
Official Symbol | LY6E |
Synonyms | LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; RIG E; SCA 2; TSA 1; ly-6E; stem cell antigen 2; thymic shared antigen 1; retinoic acid-induced gene E protein; RIGE; SCA2; RIG-E; SCA-2; TSA-1; |
Gene ID | 4061 |
mRNA Refseq | NM_001127213 |
Protein Refseq | NP_001120685 |
MIM | 601384 |
UniProt ID | Q16553 |
◆ Recombinant Proteins | ||
LY6E-2189M | Recombinant Mouse LY6E Protein (21-102 aa), His-B2M-tagged | +Inquiry |
Ly6e-1753M | Recombinant Mouse Ly6e Protein, His-tagged | +Inquiry |
Ly6e-4511M | Recombinant Mouse Ly6e protein, His&Myc-tagged | +Inquiry |
LY6E-6339C | Recombinant Chicken LY6E | +Inquiry |
Ly6e-1754R | Recombinant Rat Ly6e Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6E Products
Required fields are marked with *
My Review for All LY6E Products
Required fields are marked with *