Recombinant Human LY6E Protein (21-101 aa), His-SUMO-tagged
Cat.No. : | LY6E-1008H |
Product Overview : | Recombinant Human LY6E Protein (21-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-101 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 24.5 kDa |
AA Sequence : | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ] |
Official Symbol | LY6E |
Synonyms | LY6E; RIG E; SCA 2; TSA 1; ly-6E; RIGE; SCA2; RIG-E; SCA-2; TSA-1; |
Gene ID | 4061 |
mRNA Refseq | NM_001127213 |
Protein Refseq | NP_001120685 |
MIM | 601384 |
UniProt ID | Q16553 |
◆ Recombinant Proteins | ||
Ly6e-4511M | Recombinant Mouse Ly6e protein, His&Myc-tagged | +Inquiry |
LY6E-6339C | Recombinant Chicken LY6E | +Inquiry |
LY6E-9368M | Recombinant Mouse LY6E Protein | +Inquiry |
LY6E-1008H | Recombinant Human LY6E Protein (21-101 aa), His-SUMO-tagged | +Inquiry |
Ly6e-1753M | Recombinant Mouse Ly6e Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6E Products
Required fields are marked with *
My Review for All LY6E Products
Required fields are marked with *
0
Inquiry Basket