Recombinant Human LY6E Protein (21-101 aa), His-SUMO-tagged

Cat.No. : LY6E-1008H
Product Overview : Recombinant Human LY6E Protein (21-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 21-101 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 24.5 kDa
AA Sequence : LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ]
Official Symbol LY6E
Synonyms LY6E; RIG E; SCA 2; TSA 1; ly-6E; RIGE; SCA2; RIG-E; SCA-2; TSA-1;
Gene ID 4061
mRNA Refseq NM_001127213
Protein Refseq NP_001120685
MIM 601384
UniProt ID Q16553

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6E Products

Required fields are marked with *

My Review for All LY6E Products

Required fields are marked with *

0
cart-icon
0
compare icon