Recombinant Human LY6E Protein (21-101 aa), His-SUMO-tagged
| Cat.No. : | LY6E-1008H |
| Product Overview : | Recombinant Human LY6E Protein (21-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-101 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 24.5 kDa |
| AA Sequence : | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ] |
| Official Symbol | LY6E |
| Synonyms | LY6E; RIG E; SCA 2; TSA 1; ly-6E; RIGE; SCA2; RIG-E; SCA-2; TSA-1; |
| Gene ID | 4061 |
| mRNA Refseq | NM_001127213 |
| Protein Refseq | NP_001120685 |
| MIM | 601384 |
| UniProt ID | Q16553 |
| ◆ Recombinant Proteins | ||
| LY6E-5251M | Recombinant Mouse LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6E-1743M | Recombinant Mouse LY6E Protein (21-102 aa), His-SUMO-tagged | +Inquiry |
| LY6E-2416R | Recombinant Rhesus Macaque LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6E-1008H | Recombinant Human LY6E Protein (21-101 aa), His-SUMO-tagged | +Inquiry |
| LY6E-2407H | Recombinant Human LY6E Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6E Products
Required fields are marked with *
My Review for All LY6E Products
Required fields are marked with *



