Recombinant Human LY96 protein, His-tagged
| Cat.No. : | LY96-2240H |
| Product Overview : | Recombinant Human LY96 protein(Q9Y6Y9)(19-160aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 19-160aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.5 kDa |
| AA Sequence : | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LY96 lymphocyte antigen 96 [ Homo sapiens ] |
| Official Symbol | LY96 |
| Synonyms | LY96; lymphocyte antigen 96; MD 2; protein MD-2; myeloid differentiation protein-2; MD2; MD-2; ly-96; ESOP-1; |
| Gene ID | 23643 |
| mRNA Refseq | NM_001195797 |
| Protein Refseq | NP_001182726 |
| MIM | 605243 |
| UniProt ID | Q9Y6Y9 |
| ◆ Recombinant Proteins | ||
| LY96-327H | Recombinant Human LY96 protein, MYC/DDK-tagged | +Inquiry |
| Ly96-1551M | Recombinant Mouse Ly96 protein, His-tagged | +Inquiry |
| LY96-668C | Recombinant Cynomolgus LY96 Protein, His-tagged | +Inquiry |
| LY96-3191H | Recombinant Human LY96 protein, His-GST & Myc-tagged | +Inquiry |
| LY96-154H | Recombinant Human LY96, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY96-771MCL | Recombinant Mouse LY96 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY96 Products
Required fields are marked with *
My Review for All LY96 Products
Required fields are marked with *
