Recombinant Human LYPLA2 Protein, GST-tagged
Cat.No. : | LYPLA2-4547H |
Product Overview : | Human LYPLA2 full-length ORF ( NP_009191.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq |
Molecular Mass : | 51.1 kDa |
AA Sequence : | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYPLA2 lysophospholipase II [ Homo sapiens ] |
Official Symbol | LYPLA2 |
Synonyms | LYPLA2; lysophospholipase II; acyl-protein thioesterase 2; APT 2; LPL-II; lysoPLA II; APT-2; DJ886K2.4; |
Gene ID | 11313 |
mRNA Refseq | NM_007260 |
Protein Refseq | NP_009191 |
UniProt ID | O95372 |
◆ Recombinant Proteins | ||
LYPLA2-3972H | Recombinant Human LYPLA2 protein, His-tagged | +Inquiry |
LYPLA2-11012Z | Recombinant Zebrafish LYPLA2 | +Inquiry |
LYPLA2-6242HF | Recombinant Full Length Human LYPLA2 Protein, GST-tagged | +Inquiry |
LYPLA2-2427R | Recombinant Rhesus Macaque LYPLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA2-3518R | Recombinant Rat LYPLA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA2-4588HCL | Recombinant Human LYPLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLA2 Products
Required fields are marked with *
My Review for All LYPLA2 Products
Required fields are marked with *
0
Inquiry Basket