Recombinant Human LYRM7 Protein, GST-tagged
Cat.No. : | LYRM7-4538H |
Product Overview : | Human LYRM7 full-length ORF (1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded mitochondrial matrix protein that stabilizes UQCRFS1 and chaperones it to the CIII complex. Defects in this gene are a cause of mitochondrial complex III deficiency, nuclear type 8. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYRM7 LYR motif containing 7 [ Homo sapiens (human) ] |
Official Symbol | LYRM7 |
Synonyms | LYRM7; LYR motif containing 7; MZM1L; MC3DN8; C5orf31; complex III assembly factor LYRM7; LYR motif-containing protein 7; Lyrm7 homolog |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=90624 |
mRNA Refseq | NM_001293735 |
Protein Refseq | NP_001280664 |
MIM | 615831 |
UniProt ID | Q5U5X0 |
◆ Recombinant Proteins | ||
LYRM7-3520R | Recombinant Rat LYRM7 Protein | +Inquiry |
LYRM7-9403M | Recombinant Mouse LYRM7 Protein | +Inquiry |
LYRM7-301221H | Recombinant Human LYRM7 protein, GST-tagged | +Inquiry |
LYRM7-3176R | Recombinant Rat LYRM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYRM7-4538H | Recombinant Human LYRM7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYRM7 Products
Required fields are marked with *
My Review for All LYRM7 Products
Required fields are marked with *