"LYRM7" Related Products

Expand

Recombinant Human LYRM7 Protein, GST-tagged

Cat.No. : LYRM7-4538H
Product Overview : Human LYRM7 full-length ORF (1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded mitochondrial matrix protein that stabilizes UQCRFS1 and chaperones it to the CIII complex. Defects in this gene are a cause of mitochondrial complex III deficiency, nuclear type 8. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.84 kDa
AA Sequence : MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : LYRM7 LYR motif containing 7 [ Homo sapiens (human) ]
Official Symbol : LYRM7
Synonyms : LYRM7; LYR motif containing 7; MZM1L; MC3DN8; C5orf31; complex III assembly factor LYRM7; LYR motif-containing protein 7; Lyrm7 homolog
Gene ID : https://www.ncbi.nlm.nih.gov/gene/?term=90624
mRNA Refseq : NM_001293735
Protein Refseq : NP_001280664
MIM : 615831
UniProt ID : Q5U5X0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.