Recombinant Human LYSMD4 Protein, GST-tagged
Cat.No. : | LYSMD4-4535H |
Product Overview : | Human LYSMD4 full-length ORF ( NP_689662.2, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LYSMD4 (LysM Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is LYSMD3. |
Molecular Mass : | 58.5 kDa |
AA Sequence : | MAVGTRGTLLKKSLTVWFCGPGARSATRAVSTSLPRREQVTWCCCSGSWPRRTASTSWRCSMAANFCRHTVWLTEHGLKNEACPTKTGIDGVGFLVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYSMD4 LysM, putative peptidoglycan-binding, domain containing 4 [ Homo sapiens ] |
Official Symbol | LYSMD4 |
Synonyms | LYSMD4; LysM, putative peptidoglycan-binding, domain containing 4; lysM and putative peptidoglycan-binding domain-containing protein 4; FLJ33008; MGC99501; |
Gene ID | 145748 |
mRNA Refseq | NM_152449 |
Protein Refseq | NP_689662 |
UniProt ID | Q5XG99 |
◆ Recombinant Proteins | ||
LYSMD4-11102Z | Recombinant Zebrafish LYSMD4 | +Inquiry |
LYSMD4-4535H | Recombinant Human LYSMD4 Protein, GST-tagged | +Inquiry |
LYSMD4-9407M | Recombinant Mouse LYSMD4 Protein | +Inquiry |
LYSMD4-5277M | Recombinant Mouse LYSMD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYSMD4-6037HF | Recombinant Full Length Human LYSMD4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYSMD4-4581HCL | Recombinant Human LYSMD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYSMD4 Products
Required fields are marked with *
My Review for All LYSMD4 Products
Required fields are marked with *