Recombinant Human LYPLAL1 protein, His-tagged
| Cat.No. : | LYPLAL1-6958H |
| Product Overview : | Recombinant Human LYPLAL1 protein(1-237 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-237 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | LYPLAL1 lysophospholipase-like 1 [ Homo sapiens ] |
| Official Symbol | LYPLAL1 |
| Synonyms | LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238; |
| Gene ID | 127018 |
| mRNA Refseq | NM_138794 |
| Protein Refseq | NP_620149 |
| UniProt ID | Q5VWZ2 |
| ◆ Recombinant Proteins | ||
| Lyplal1-3880M | Recombinant Mouse Lyplal1 Protein, Myc/DDK-tagged | +Inquiry |
| LYPLAL1-6246HF | Recombinant Full Length Human LYPLAL1 Protein, GST-tagged | +Inquiry |
| LYPLAL1-2608R | Recombinant Rhesus monkey LYPLAL1 Protein, His-tagged | +Inquiry |
| LYPLAL1-2428R | Recombinant Rhesus Macaque LYPLAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYPLAL1-4953C | Recombinant Chicken LYPLAL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLAL1 Products
Required fields are marked with *
My Review for All LYPLAL1 Products
Required fields are marked with *
