Recombinant Human LZIC protein, GST-tagged
Cat.No. : | LZIC-3678H |
Product Overview : | Recombinant Human LZIC protein(1-190 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-190 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens ] |
Official Symbol | LZIC |
Synonyms | LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein; |
Gene ID | 84328 |
mRNA Refseq | NM_032368 |
Protein Refseq | NP_115744 |
MIM | 610458 |
UniProt ID | Q8WZA0 |
◆ Recombinant Proteins | ||
LZIC-674H | Recombinant Human LZIC, His-tagged | +Inquiry |
Lzic-3885M | Recombinant Mouse Lzic Protein, Myc/DDK-tagged | +Inquiry |
LZIC-3179R | Recombinant Rat LZIC Protein, His (Fc)-Avi-tagged | +Inquiry |
LZIC-1828C | Recombinant Chicken LZIC | +Inquiry |
LZIC-409H | Recombinant Human leucine zipper and CTNNBIP1 domain containing, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LZIC Products
Required fields are marked with *
My Review for All LZIC Products
Required fields are marked with *
0
Inquiry Basket