Recombinant Human MACROD1 protein, His&Myc-tagged
| Cat.No. : | MACROD1-4379H |
| Product Overview : | Recombinant Human MACROD1 protein(Q9BQ69)(1-325aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 1-325aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.4 kDa |
| AA Sequence : | MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | MACROD1 MACRO domain containing 1 [ Homo sapiens ] |
| Official Symbol | MACROD1 |
| Synonyms | LRP16 |
| Gene ID | 28992 |
| mRNA Refseq | NM_014067.3 |
| Protein Refseq | NP_054786.2 |
| MIM | 610400 |
| UniProt ID | Q9BQ69 |
| ◆ Recombinant Proteins | ||
| MACROD1-1295Z | Recombinant Zebrafish MACROD1 | +Inquiry |
| MACROD1-3416H | Recombinant Human MACROD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MACROD1-4380H | Recombinant Human MACROD1 protein, His-tagged | +Inquiry |
| MACROD1-4379H | Recombinant Human MACROD1 protein, His&Myc-tagged | +Inquiry |
| MACROD1-2437R | Recombinant Rhesus Macaque MACROD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MACROD1-399HCL | Recombinant Human MACROD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MACROD1 Products
Required fields are marked with *
My Review for All MACROD1 Products
Required fields are marked with *


