Recombinant Human MACROD1 protein, His-tagged
Cat.No. : | MACROD1-4380H |
Product Overview : | Recombinant Human MACROD1 protein(Q9BQ69)(1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-325aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MACROD1 MACRO domain containing 1 [ Homo sapiens ] |
Official Symbol | MACROD1 |
Synonyms | LRP16 |
Gene ID | 28992 |
mRNA Refseq | NM_014067.3 |
Protein Refseq | NP_054786.2 |
MIM | 610400 |
UniProt ID | Q9BQ69 |
◆ Recombinant Proteins | ||
MACROD1-993H | Recombinant Human MACROD1 | +Inquiry |
MACROD1-4379H | Recombinant Human MACROD1 protein, His&Myc-tagged | +Inquiry |
MACROD1-3527R | Recombinant Rat MACROD1 Protein | +Inquiry |
MACROD1-1295Z | Recombinant Zebrafish MACROD1 | +Inquiry |
MACROD1-4380H | Recombinant Human MACROD1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MACROD1-399HCL | Recombinant Human MACROD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MACROD1 Products
Required fields are marked with *
My Review for All MACROD1 Products
Required fields are marked with *
0
Inquiry Basket