Recombinant Human MAD2L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MAD2L1-6573H
Product Overview : MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.
Molecular Mass : 23.5 kDa
AA Sequence : MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVNDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MAD2L1 mitotic arrest deficient 2 like 1 [ Homo sapiens (human) ]
Official Symbol MAD2L1
Synonyms MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2; MAD2-like protein 1; mitotic arrest deficient 2-like protein 1; mitotic arrest deficient, yeast, homolog-like 1; MAD2 (mitotic arrest deficient, yeast, homolog)-like 1;
Gene ID 4085
mRNA Refseq NM_002358
Protein Refseq NP_002349
MIM 601467
UniProt ID Q13257

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAD2L1 Products

Required fields are marked with *

My Review for All MAD2L1 Products

Required fields are marked with *

0
cart-icon