Recombinant Human MAD2L2 protein, His-tagged
| Cat.No. : | MAD2L2-2787H |
| Product Overview : | Recombinant Human MAD2L2 protein(2-211 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-211 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAD2L2 MAD2 mitotic arrest deficient-like 2 (yeast) [ Homo sapiens ] |
| Official Symbol | MAD2L2 |
| Synonyms | MAD2L2; MAD2 mitotic arrest deficient-like 2 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 2; mitotic spindle assembly checkpoint protein MAD2B; MAD2B; mitotic arrest deficient homolog like 2; REV7; hREV7; REV7 homolog; MAD2-like protein 2; mitotic arrest deficient homolog-like 2; mitotic arrest deficient 2-like protein 2; MAD2 (mitotic arrest deficient, yeast, homolog)-like 2; |
| Gene ID | 10459 |
| mRNA Refseq | NM_001127325 |
| Protein Refseq | NP_001120797 |
| MIM | 604094 |
| UniProt ID | Q9UI95 |
| ◆ Recombinant Proteins | ||
| MAD2L2-2620R | Recombinant Rhesus monkey MAD2L2 Protein, His-tagged | +Inquiry |
| MAD2L2-3184R | Recombinant Rat MAD2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAD2L2-2787H | Recombinant Human MAD2L2 protein, His-tagged | +Inquiry |
| MAD2L2-3528R | Recombinant Rat MAD2L2 Protein | +Inquiry |
| MAD2L2-683H | Recombinant Human MAD2L2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAD2L2-4567HCL | Recombinant Human MAD2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAD2L2 Products
Required fields are marked with *
My Review for All MAD2L2 Products
Required fields are marked with *
