Recombinant Human MAD2L2 protein, His-tagged

Cat.No. : MAD2L2-2787H
Product Overview : Recombinant Human MAD2L2 protein(2-211 aa), fused to His tag, was expressed in E. coli.
Availability June 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-211 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAD2L2 MAD2 mitotic arrest deficient-like 2 (yeast) [ Homo sapiens ]
Official Symbol MAD2L2
Synonyms MAD2L2; MAD2 mitotic arrest deficient-like 2 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 2; mitotic spindle assembly checkpoint protein MAD2B; MAD2B; mitotic arrest deficient homolog like 2; REV7; hREV7; REV7 homolog; MAD2-like protein 2; mitotic arrest deficient homolog-like 2; mitotic arrest deficient 2-like protein 2; MAD2 (mitotic arrest deficient, yeast, homolog)-like 2;
Gene ID 10459
mRNA Refseq NM_001127325
Protein Refseq NP_001120797
MIM 604094
UniProt ID Q9UI95

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAD2L2 Products

Required fields are marked with *

My Review for All MAD2L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon