Recombinant Human MAF

• Cat.No.: MAF-26878TH
• Product Overview: Recombinant fragment of Human c-Maf with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in endothelial cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
• Sequence Similarities: Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain.

Gene Information

• Gene Name: MAF v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) [ Homo sapiens ]
• Official Symbol: MAF
• Synonyms: MAF; v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian); v maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog; transcription factor Maf; c MAF
• Gene ID: 4094
• mRNA Refseq: NM_001031804
• Protein Refseq: NP_001026974
• MIM: 177075
• Uniprot ID: O75444
• Chromosome Location: 16q22-q23
• Pathway: C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Keap1-Nrf2 Pathway, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity