Recombinant Human MAF
Cat.No. : | MAF-26878TH |
Product Overview : | Recombinant fragment of Human c-Maf with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in endothelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK |
Sequence Similarities : | Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain. |
Gene Name | MAF v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) [ Homo sapiens ] |
Official Symbol | MAF |
Synonyms | MAF; v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian); v maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog; transcription factor Maf; c MAF; |
Gene ID | 4094 |
mRNA Refseq | NM_001031804 |
Protein Refseq | NP_001026974 |
MIM | 177075 |
Uniprot ID | O75444 |
Chromosome Location | 16q22-q23 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Keap1-Nrf2 Pathway, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MAF-9351Z | Recombinant Zebrafish MAF | +Inquiry |
MAF-9435M | Recombinant Mouse MAF Protein | +Inquiry |
MAF-5294M | Recombinant Mouse MAF Protein, His (Fc)-Avi-tagged | +Inquiry |
MAF-3188R | Recombinant Rat MAF Protein, His (Fc)-Avi-tagged | +Inquiry |
MAF-3532R | Recombinant Rat MAF Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAF Products
Required fields are marked with *
My Review for All MAF Products
Required fields are marked with *
0
Inquiry Basket