Recombinant Human MAF

Cat.No. : MAF-26878TH
Product Overview : Recombinant fragment of Human c-Maf with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in endothelial cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Sequence Similarities : Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain.
Gene Name MAF v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) [ Homo sapiens ]
Official Symbol MAF
Synonyms MAF; v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian); v maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog; transcription factor Maf; c MAF;
Gene ID 4094
mRNA Refseq NM_001031804
Protein Refseq NP_001026974
MIM 177075
Uniprot ID O75444
Chromosome Location 16q22-q23
Pathway C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Keap1-Nrf2 Pathway, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAF Products

Required fields are marked with *

My Review for All MAF Products

Required fields are marked with *

0
cart-icon
0
compare icon