Recombinant Human MAG
Cat.No. : | MAG-29106TH |
Product Overview : | Recombinant fragment corresponding to amino acids 119-208 of Human MAG with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR |
Gene Name | MAG myelin associated glycoprotein [ Homo sapiens ] |
Official Symbol | MAG |
Synonyms | MAG; myelin associated glycoprotein; GMA; myelin-associated glycoprotein; S MAG; sialic acid binding Ig like lectin 4A; SIGLEC 4A; SIGLEC4A; |
Gene ID | 4099 |
mRNA Refseq | NM_001199216 |
Protein Refseq | NP_001186145 |
MIM | 159460 |
Uniprot ID | P20916 |
Chromosome Location | 19q13.1 |
Pathway | Axonal growth inhibition (RHOA activation), organism-specific biosystem; Basigin interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; |
Function | sugar binding; |
◆ Recombinant Proteins | ||
MAG-1067H | Recombinant Human MAG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAG-29106TH | Recombinant Human MAG | +Inquiry |
MAG-4484H | Recombinant Human MAG Protein (Gly20-Pro516), C-His tagged | +Inquiry |
MAG-0507H | Recombinant Human MAG protein, hFc-tagged | +Inquiry |
MAG-175H | Recombinant Human MAG Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAG-1681HCL | Recombinant Human MAG cell lysate | +Inquiry |
MAG-1315HCL | Recombinant Human MAG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAG Products
Required fields are marked with *
My Review for All MAG Products
Required fields are marked with *
0
Inquiry Basket