Recombinant Human MAG

Cat.No. : MAG-29106TH
Product Overview : Recombinant fragment corresponding to amino acids 119-208 of Human MAG with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
Gene Name MAG myelin associated glycoprotein [ Homo sapiens ]
Official Symbol MAG
Synonyms MAG; myelin associated glycoprotein; GMA; myelin-associated glycoprotein; S MAG; sialic acid binding Ig like lectin 4A; SIGLEC 4A; SIGLEC4A;
Gene ID 4099
mRNA Refseq NM_001199216
Protein Refseq NP_001186145
MIM 159460
Uniprot ID P20916
Chromosome Location 19q13.1
Pathway Axonal growth inhibition (RHOA activation), organism-specific biosystem; Basigin interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem;
Function sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAG Products

Required fields are marked with *

My Review for All MAG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon