Recombinant Human MAGEA6 protein, T7/His-tagged

Cat.No. : MAGEA6-232H
Product Overview : Recombinant human MAGEA6 cDNA (2 – 314 aa, which derived from BC067731) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-314 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVE VTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLL KYRAREPVTKAEMLGSVVGNWQYFFPVIFIKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMP KTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFL WGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALREGEE
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ]
Official Symbol MAGEA6
Synonyms MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6; MAGE-6 antigen; MAGE3B antigen; cancer/testis antigen 1.6; cancer/testis antigen family 1, member 6; MAGE3B; MAGE-3b; MGC52297;
Gene ID 4105
mRNA Refseq NM_005363
Protein Refseq NP_005354
MIM 300176
UniProt ID P43360
Chromosome Location Xq28
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGEA6 Products

Required fields are marked with *

My Review for All MAGEA6 Products

Required fields are marked with *

0
cart-icon