Recombinant Human MAGEA6 protein, T7/His-tagged
| Cat.No. : | MAGEA6-232H | 
| Product Overview : | Recombinant human MAGEA6 cDNA (2 – 314 aa, which derived from BC067731) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 2-314 a.a. | 
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVE VTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLL KYRAREPVTKAEMLGSVVGNWQYFFPVIFIKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMP KTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFL WGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALREGEE | 
| Purity : | >90% by SDS-PAGE | 
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ] | 
| Official Symbol | MAGEA6 | 
| Synonyms | MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6; MAGE-6 antigen; MAGE3B antigen; cancer/testis antigen 1.6; cancer/testis antigen family 1, member 6; MAGE3B; MAGE-3b; MGC52297; | 
| Gene ID | 4105 | 
| mRNA Refseq | NM_005363 | 
| Protein Refseq | NP_005354 | 
| MIM | 300176 | 
| UniProt ID | P43360 | 
| Chromosome Location | Xq28 | 
| Function | molecular_function; | 
| ◆ Recombinant Proteins | ||
| MAGEA6-6788H | Recombinant Human Melanoma Antigen Family A, 6, His-tagged | +Inquiry | 
| MAGEA6-3200H | Recombinant Human MAGEA6 protein, His&Myc-tagged | +Inquiry | 
| MAGEA6-296HF | Recombinant Full Length Human MAGEA6 Protein | +Inquiry | 
| MAGEA6-3419H | Recombinant Human MAGEA6 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MAGEA6-403H | Recombinant Human MAGEA6 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MAGEA6-4551HCL | Recombinant Human MAGEA6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All MAGEA6 Products
Required fields are marked with *
My Review for All MAGEA6 Products
Required fields are marked with *
  
        
    
      
            