Recombinant Human MAGI2 protein, GST-tagged
| Cat.No. : | MAGI2-6744H |
| Product Overview : | Recombinant Human MAGI2 protein(563-912 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 563-912 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | DRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRRPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MAGI2 membrane associated guanylate kinase, WW and PDZ domain containing 2 [ Homo sapiens ] |
| Official Symbol | MAGI2 |
| Synonyms | MAGI2; membrane associated guanylate kinase, WW and PDZ domain containing 2; membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2; ACVRIP1; AIP1; ARIP1; KIAA0705; MAGI 2; atrophin-1-interacting protein 1; atrophin-1-interacting protein A; activin receptor interacting protein 1; membrane-associated guanylate kinase inverted 2; AIP-1; SSCAM; MAGI-2; |
| Gene ID | 9863 |
| mRNA Refseq | NM_012301 |
| Protein Refseq | NP_036433 |
| MIM | 606382 |
| UniProt ID | Q86UL8 |
| ◆ Recombinant Proteins | ||
| MAGI2-6744H | Recombinant Human MAGI2 protein, GST-tagged | +Inquiry |
| MAGI2-5578H | Recombinant Human MAGI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MAGI2-3198R | Recombinant Rat MAGI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAGI2-333HFL | Recombinant Full Length Human MAGI2 Protein, C-Flag-tagged | +Inquiry |
| MAGI2-5302M | Recombinant Mouse MAGI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGI2 Products
Required fields are marked with *
My Review for All MAGI2 Products
Required fields are marked with *
