Recombinant Human MAP1B protein, His-tagged

• Cat.No.: MAP1B-30119H
• Product Overview: Recombinant Human MAP1B protein(414-567 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 414-567 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MAP1B microtubule-associated protein 1B [ Homo sapiens ]
• Official Symbol: MAP1B
• Synonyms: MAP1B; microtubule-associated protein 1B; MAP5; MAP-1B; FUTSCH; FLJ38954; DKFZp686E1099; DKFZp686F1345
• Gene ID: 4131
• mRNA Refseq: NM_005909
• Protein Refseq: NP_005900
• MIM: 157129
• UniProt ID: P46821