Recombinant Human MAP1B protein, GST-tagged
Cat.No. : | MAP1B-30119H |
Product Overview : | Recombinant Human MAP1B (414-567 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp414-Lys567 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAP1B microtubule-associated protein 1B [ Homo sapiens ] |
Official Symbol | MAP1B |
Synonyms | MAP1B; microtubule-associated protein 1B; MAP5; MAP-1B; FUTSCH; FLJ38954; DKFZp686E1099; DKFZp686F1345; |
Gene ID | 4131 |
mRNA Refseq | NM_005909 |
Protein Refseq | NP_005900 |
MIM | 157129 |
UniProt ID | P46821 |
◆ Recombinant Proteins | ||
MAP1B-3807H | Recombinant Human MAP1B protein, His-tagged | +Inquiry |
MAP1B-283H | Recombinant Human MAP1B | +Inquiry |
MAP1B-30119H | Recombinant Human MAP1B protein, GST-tagged | +Inquiry |
MAP1B-4492H | Recombinant Human MAP1B Protein (Lys414-Glu567), N-His tagged | +Inquiry |
MAP1B-8189H | Recombinant Human MAP1B protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP1B Products
Required fields are marked with *
My Review for All MAP1B Products
Required fields are marked with *
0
Inquiry Basket