Recombinant Human MAP1LC3C protein, His-tagged

Cat.No. : MAP1LC3C-731H
Product Overview : Recombinant Human MAP1LC3C protein(59-110 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 59-110 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : LVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKD
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name MAP1LC3C microtubule-associated protein 1 light chain 3 gamma [ Homo sapiens ]
Official Symbol MAP1LC3C
Synonyms MAP1LC3C; microtubule-associated protein 1 light chain 3 gamma; microtubule-associated proteins 1A/1B light chain 3C; ATG8J; MAP1A/MAP1B LC3 C; LC3-like protein 2; MAP1A/MAP1B light chain 3 C; autophagy-related protein LC3 C; MAP1 light chain 3-like protein 2; MAP1 light chain 3-like protein 3; autophagy-related ubiquitin-like modifier LC3 C; LC3C;
mRNA Refseq NM_001004343
Protein Refseq NP_001004343
MIM 609605
UniProt ID Q9BXW4
Gene ID 440738

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAP1LC3C Products

Required fields are marked with *

My Review for All MAP1LC3C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon