Recombinant Human MAP1LC3C protein, His-tagged
| Cat.No. : | MAP1LC3C-731H |
| Product Overview : | Recombinant Human MAP1LC3C protein(59-110 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 59-110 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | LVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKD |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | MAP1LC3C microtubule-associated protein 1 light chain 3 gamma [ Homo sapiens ] |
| Official Symbol | MAP1LC3C |
| Synonyms | MAP1LC3C; microtubule-associated protein 1 light chain 3 gamma; microtubule-associated proteins 1A/1B light chain 3C; ATG8J; MAP1A/MAP1B LC3 C; LC3-like protein 2; MAP1A/MAP1B light chain 3 C; autophagy-related protein LC3 C; MAP1 light chain 3-like protein 2; MAP1 light chain 3-like protein 3; autophagy-related ubiquitin-like modifier LC3 C; LC3C; |
| mRNA Refseq | NM_001004343 |
| Protein Refseq | NP_001004343 |
| MIM | 609605 |
| UniProt ID | Q9BXW4 |
| Gene ID | 440738 |
| ◆ Recombinant Proteins | ||
| MAP1LC3C-2414H | Recombinant Human MAP1LC3C Protein, His-tagged | +Inquiry |
| MAP1LC3C-7311H | Recombinant Human MAP1LC3C protein, His-tagged | +Inquiry |
| MAP1LC3C-731H | Recombinant Human MAP1LC3C protein, His-tagged | +Inquiry |
| MAP1LC3C-4914H | Recombinant Human MAP1LC3C protein, His-tagged | +Inquiry |
| MAP1LC3C-10629Z | Recombinant Zebrafish MAP1LC3C | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP1LC3C-1053HCL | Recombinant Human MAP1LC3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP1LC3C Products
Required fields are marked with *
My Review for All MAP1LC3C Products
Required fields are marked with *
