Recombinant Human MAP2K6 protein, His-tagged

Cat.No. : MAP2K6-2241H
Product Overview : Recombinant Human MAP2K6 protein(P52564)(1-334aa), fused to N-terminal His tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-334aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.5 kDa
AA Sequence : MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name MAP2K6 mitogen-activated protein kinase kinase 6 [ Homo sapiens ]
Official Symbol MAP2K6
Synonyms MAP2K6; mitogen-activated protein kinase kinase 6; PRKMK6; dual specificity mitogen-activated protein kinase kinase 6; MAPKK6; MEK6; MKK6; protein kinase; mitogen activated; kinase 6 (MAP kinase kinase 6); SAPKK3; MEK 6; MAPKK 6; SAPK kinase 3; MAPK/ERK kinase 6; stress-activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPKK-3;
Gene ID 5608
mRNA Refseq NM_002758
Protein Refseq NP_002749
MIM 601254
UniProt ID P52564

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP2K6 Products

Required fields are marked with *

My Review for All MAP2K6 Products

Required fields are marked with *

0
cart-icon
0
compare icon