Recombinant Human MAP6 protein, His-tagged
Cat.No. : | MAP6-3934H |
Product Overview : | Recombinant Human MAP6 protein(1-172 aa), fused to His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-172 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVHETSYSAQFKGEASKPTTADNKVIDRRRIRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPMIP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAP6 microtubule-associated protein 6 [ Homo sapiens ] |
Official Symbol | MAP6 |
Synonyms | MAP6; microtubule-associated protein 6; FLJ41346; KIAA1878; STOP; MAP-6; stable tubule-only polypeptide; MTAP6; N-STOP; |
Gene ID | 4135 |
mRNA Refseq | NM_033063 |
Protein Refseq | NP_149052 |
MIM | 601783 |
UniProt ID | Q96JE9 |
◆ Recombinant Proteins | ||
MAP6-5339M | Recombinant Mouse MAP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP6-3570R | Recombinant Rat MAP6 Protein | +Inquiry |
MAP6-3226R | Recombinant Rat MAP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Map6-6828M | Recombinant Mouse Map6 protein, His & T7-tagged | +Inquiry |
MAP6-6481C | Recombinant Chicken MAP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP6-401HCL | Recombinant Human MAP6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP6 Products
Required fields are marked with *
My Review for All MAP6 Products
Required fields are marked with *