Recombinant Human MAPK1IP1L protein, hFc-tagged
Cat.No. : | MAPK1IP1L-4633H |
Product Overview : | Recombinant Human MAPK1IP1L protein(Q8NDC0)(2-245aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 2-245aa |
Tag : | C-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH |
Gene Name | MAPK1IP1L mitogen-activated protein kinase 1 interacting protein 1-like [ Homo sapiens ] |
Official Symbol | MAPK1IP1L |
Synonyms | MAPK1IP1L; mitogen-activated protein kinase 1 interacting protein 1-like; C14orf32, chromosome 14 open reading frame 32 , mitogen activated protein kinase 1 interacting protein 1 like; MAPK-interacting and spindle-stabilizing protein-like; MAPK-interacting and spindle-stabilizing protein; mitogen activated protein kinase 1 interacting protein 1-like; mitogen-activated protein kinase 1-interacting protein 1-like; MISS; C14orf32; c14_5346; MGC23138; |
Gene ID | 93487 |
mRNA Refseq | NM_144578 |
Protein Refseq | NP_653179 |
UniProt ID | Q8NDC0 |
◆ Recombinant Proteins | ||
MAPK1IP1L-423C | Recombinant Cynomolgus Monkey MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPK1IP1L-677C | Recombinant Cynomolgus MAPK1IP1L Protein, His-tagged | +Inquiry |
MAPK1IP1L-2492R | Recombinant Rhesus Macaque MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPK1IP1L-4633H | Recombinant Human MAPK1IP1L protein, hFc-tagged | +Inquiry |
MAPK1IP1L-9533M | Recombinant Mouse MAPK1IP1L Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK1IP1L-4495HCL | Recombinant Human MAPK1IP1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK1IP1L Products
Required fields are marked with *
My Review for All MAPK1IP1L Products
Required fields are marked with *
0
Inquiry Basket