Recombinant Human MAPK1IP1L protein, hFc-tagged
| Cat.No. : | MAPK1IP1L-4633H |
| Product Overview : | Recombinant Human MAPK1IP1L protein(Q8NDC0)(2-245aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 2-245aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH |
| Gene Name | MAPK1IP1L mitogen-activated protein kinase 1 interacting protein 1-like [ Homo sapiens ] |
| Official Symbol | MAPK1IP1L |
| Synonyms | MAPK1IP1L; mitogen-activated protein kinase 1 interacting protein 1-like; C14orf32, chromosome 14 open reading frame 32 , mitogen activated protein kinase 1 interacting protein 1 like; MAPK-interacting and spindle-stabilizing protein-like; MAPK-interacting and spindle-stabilizing protein; mitogen activated protein kinase 1 interacting protein 1-like; mitogen-activated protein kinase 1-interacting protein 1-like; MISS; C14orf32; c14_5346; MGC23138; |
| Gene ID | 93487 |
| mRNA Refseq | NM_144578 |
| Protein Refseq | NP_653179 |
| UniProt ID | Q8NDC0 |
| ◆ Recombinant Proteins | ||
| MAPK1IP1L-4633H | Recombinant Human MAPK1IP1L protein, hFc-tagged | +Inquiry |
| MAPK1IP1L-2492R | Recombinant Rhesus Macaque MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAPK1IP1L-5349M | Recombinant Mouse MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAPK1IP1L-423C | Recombinant Cynomolgus Monkey MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAPK1IP1L-2672R | Recombinant Rhesus monkey MAPK1IP1L Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPK1IP1L-4495HCL | Recombinant Human MAPK1IP1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPK1IP1L Products
Required fields are marked with *
My Review for All MAPK1IP1L Products
Required fields are marked with *



