Recombinant Human MAPK1IP1L protein, hFc-tagged

Cat.No. : MAPK1IP1L-4633H
Product Overview : Recombinant Human MAPK1IP1L protein(Q8NDC0)(2-245aa), fused with C-terminal hFc tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 2-245aa
Tag : C-hFc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.1 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH
Gene Name MAPK1IP1L mitogen-activated protein kinase 1 interacting protein 1-like [ Homo sapiens ]
Official Symbol MAPK1IP1L
Synonyms MAPK1IP1L; mitogen-activated protein kinase 1 interacting protein 1-like; C14orf32, chromosome 14 open reading frame 32 , mitogen activated protein kinase 1 interacting protein 1 like; MAPK-interacting and spindle-stabilizing protein-like; MAPK-interacting and spindle-stabilizing protein; mitogen activated protein kinase 1 interacting protein 1-like; mitogen-activated protein kinase 1-interacting protein 1-like; MISS; C14orf32; c14_5346; MGC23138;
Gene ID 93487
mRNA Refseq NM_144578
Protein Refseq NP_653179
UniProt ID Q8NDC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK1IP1L Products

Required fields are marked with *

My Review for All MAPK1IP1L Products

Required fields are marked with *

0
cart-icon